DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and pfn2b

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_958493.1 Gene:pfn2b / 394235 ZFINID:ZDB-GENE-040115-4 Length:140 Species:Danio rerio


Alignment Length:150 Identity:38/150 - (25%)
Similarity:57/150 - (38%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLASQCVTKACIAGHDGN---IW-AQSSG--FEVTKEELSKLISGFDQQDGLTSN 59
            |||..||:|.:....| ..|.|.|....   :| ||..|  ..:|..|:..|: |.|:|...| |
Zfish     1 MSWASYVENLMSDGSC-QDAAIVGCTAEAKYVWGAQEGGTFANITPTEIDVLV-GKDRQSFFT-N 62

  Fly    60 GVTLAGQRYIYLSGTDRVVRAKLGRSGVHCM------------------KTTQAVIVSIYEDPVQ 106
            |:||..::.       .|:|..|...|...|                  |.|:.:|:...::.:.
Zfish    63 GLTLGSKKC-------SVIRDNLTTEGDWTMDIRTKSQGGEPTYNIAVGKATKTLIMVKGKEGIH 120

  Fly   107 PQQAASVVEKLGDYLITCGY 126
            ..|.......:.:||...||
Zfish   121 GGQLNKKTYTMAEYLRRSGY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 36/148 (24%)
pfn2bNP_958493.1 PROF 1..140 CDD:214646 36/148 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101239
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.