DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn4

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001348076.1 Gene:Pfn4 / 382562 MGIID:1920121 Length:129 Species:Mus musculus


Alignment Length:122 Identity:34/122 - (27%)
Similarity:55/122 - (45%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVDNQLLASQCVTK-----ACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLT-SNGVTLA 64
            ::.|.||.:...||     |.|...:..:...|.||.|...::..|::||.:...|| ..|:...
Mouse     3 HLQNLLLDTLLGTKHVDSAALIKLQEKTLCVTSPGFSVMPSDVRTLLNGFAKNPLLTRREGLYFK 67

  Fly    65 GQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYL 121
            .:.|..:...|..:.||...:||..:||...::|:.|...:.|.......||||:||
Mouse    68 EKDYKCVRADDYSLYAKNENTGVVVVKTNMYLVVATYTAGMYPSVCVEATEKLGEYL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 34/122 (28%)
Pfn4NP_001348076.1 Profilin 14..126 CDD:365966 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844136
Domainoid 1 1.000 43 1.000 Domainoid score I12353
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5495
Isobase 1 0.950 - 0 Normalized mean entropy S2356
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R984
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.