DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and PFN4

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_955378.1 Gene:PFN4 / 375189 HGNCID:31103 Length:129 Species:Homo sapiens


Alignment Length:124 Identity:35/124 - (28%)
Similarity:52/124 - (41%) Gaps:24/124 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIY 70
            :||:..|........|:|         |.||.||..::..|::||       :.....|.:..:|
Human    17 HVDSAALIKIQERSLCVA---------SPGFNVTPSDVRTLVNGF-------AKNPLQARREGLY 65

  Fly    71 LSGTD-RVVR-------AKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYL 121
            ..|.| |.||       ||...:||..:||...::|:.|.:.:.|.......|.|||||
Human    66 FKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESLGDYL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 35/124 (28%)
PFN4NP_955378.1 PROF 14..129 CDD:238085 35/124 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153903
Domainoid 1 1.000 43 1.000 Domainoid score I12393
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 43 1.000 Inparanoid score I5504
Isobase 1 0.950 - 0 Normalized mean entropy S2356
OMA 1 1.010 - - QHG53820
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R984
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.