DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and AgaP_AGAP009861

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_553744.3 Gene:AgaP_AGAP009861 / 3292084 VectorBaseID:AGAP009861 Length:126 Species:Anopheles gambiae


Alignment Length:126 Identity:103/126 - (81%)
Similarity:118/126 - (93%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAG 65
            |||||||||||||||||:||.||||||.:||:|.||||:|||::|::.|||:.:.|||.||||||
Mosquito     1 MSWQDYVDNQLLASQCVSKAAIAGHDGGVWAKSEGFEVSKEEVAKIVQGFDKTELLTSGGVTLAG 65

  Fly    66 QRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY 126
            ||||||||||||:|||||::|||||||.|||||||||:|||||||||:|||||||||||||
Mosquito    66 QRYIYLSGTDRVIRAKLGKTGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDYLITCGY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 101/124 (81%)
AgaP_AGAP009861XP_553744.3 Profilin 1..122 CDD:395179 97/120 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 222 1.000 Domainoid score I5667
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40274
Inparanoid 1 1.050 221 1.000 Inparanoid score I5946
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 1 1.000 - - oto107194
Panther 1 1.100 - - LDO PTHR11604
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4911
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.