DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and cdc3

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_593827.1 Gene:cdc3 / 2543526 PomBaseID:SPAC4A8.15c Length:127 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:47/127 - (37%)
Similarity:72/127 - (56%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLASQCVTKACIAGHDG-NIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLA 64
            ||||.|||..||.:..:.:|.|....| ::||.|:||.::.:|:..|.:||.....:...|:.||
pombe     1 MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILA 65

  Fly    65 GQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY 126
            ||:||.:....|.:..||.:.|:.|:.|...::||.|.:...|.:||.:.|.|.|||:..||
pombe    66 GQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 45/125 (36%)
cdc3NP_593827.1 PROF 2..127 CDD:238085 44/124 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I1882
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40274
Inparanoid 1 1.050 97 1.000 Inparanoid score I1683
OMA 1 1.010 - - QHG53820
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 1 1.000 - - oto100879
orthoMCL 1 0.900 - - OOG6_101239
Panther 1 1.100 - - LDO PTHR11604
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R984
SonicParanoid 1 1.000 - - X4911
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.