DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Pfn1

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_035202.1 Gene:Pfn1 / 18643 MGIID:97549 Length:140 Species:Mus musculus


Alignment Length:119 Identity:25/119 - (21%)
Similarity:44/119 - (36%) Gaps:35/119 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGHDG-NIWAQSSG---FEVTKEELSKLISGFDQQDGLTSNGVTL 63
            |..|:|:.:....|...|.:...|. ::||...|   ..:|..|:..|: |.|:..... ||:||
Mouse     4 WNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLV-GKDRSSFFV-NGLTL 66

  Fly    64 AGQR-----------------------------YIYLSGTDRVVRAKLGRSGVH 88
            .||:                             .:.::.|.:.:...:|:.|||
Mouse    67 GGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 25/119 (21%)
Pfn1NP_035202.1 PROF 2..140 CDD:214646 25/119 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.