DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and pfn-2

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_508910.3 Gene:pfn-2 / 180808 WormBaseID:WBGene00003990 Length:131 Species:Caenorhabditis elegans


Alignment Length:128 Identity:37/128 - (28%)
Similarity:64/128 - (50%) Gaps:4/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WQDYVDNQLLASQCVTKACIAGHDGNIWAQS---SGFEVTKEELSKLISGFDQQDGLTSNGVTLA 64
            |.||:......|..:.:|.|.|.||::||:|   :.|..|:.||.:..:.|:..:.:...|..|.
 Worm     4 WDDYIKLLFGKSPAIKRAAIIGSDGSVWARSGDANAFRATEVELKRFAALFNDINSVPGTGADLE 68

  Fly    65 GQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYE-DPVQPQQAASVVEKLGDYLITCGY 126
            ...||.....::::..|..::|....||.||:::::|| |..|.....:.||.:..||.:.||
 Worm    69 EIHYIVPRVEEKLIFGKKEQTGFFAAKTNQAIVIAMYEGDNAQSASVRAGVEYIAQYLASSGY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 35/126 (28%)
pfn-2NP_508910.3 PROF 2..131 CDD:214646 35/126 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11604
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.