DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and pfn-3

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_508205.1 Gene:pfn-3 / 180460 WormBaseID:WBGene00003991 Length:126 Species:Caenorhabditis elegans


Alignment Length:127 Identity:50/127 - (39%)
Similarity:70/127 - (55%) Gaps:2/127 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAG 65
            |||.|.::|.|:.|..|:||.|.|.||.:||:|..|.::.||.......|...|.|...|:.|.|
 Worm     1 MSWSDIINNNLIGSGNVSKAAILGFDGAVWAKSDNFNISVEEAVAAGKAFTSLDALLGTGLRLEG 65

  Fly    66 QRYIYLSG-TDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY 126
            |:::.|:. .||:: .|.|.||....||.||||:||||..:||:..:.....|.||..:..|
 Worm    66 QKFLVLNADNDRII-GKQGGSGFFIYKTIQAVIISIYEKGLQPEMCSKTTGALADYFRSIKY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 49/125 (39%)
pfn-3NP_508205.1 PROF 2..126 CDD:238085 48/124 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167681
Domainoid 1 1.000 94 1.000 Domainoid score I4722
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40274
Inparanoid 1 1.050 94 1.000 Inparanoid score I3641
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 1 1.000 - - oto20011
orthoMCL 1 0.900 - - OOG6_101239
Panther 1 1.100 - - LDO PTHR11604
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R984
SonicParanoid 1 1.000 - - X4911
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.