DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and Mk1

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_599226.1 Gene:Mk1 / 171436 RGDID:621165 Length:125 Species:Rattus norvegicus


Alignment Length:85 Identity:20/85 - (23%)
Similarity:29/85 - (34%) Gaps:16/85 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NIWAQSSG---FEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSG--- 86
            :|||...|   ..:|..|.. |:.|.| ......|.:||.||:.....|.....|.....|.   
  Rat    24 SIWAAIPGKNFVSITLAEFG-LMVGKD-WSSFFMNSLTLGGQKMFCDPGLTAASRGIYNGSSYQE 86

  Fly    87 --------VHCMKTTQAVIV 98
                    .||..|.:.:::
  Rat    87 HWRNPHLQCHCTMTAKMLLL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 20/85 (24%)
Mk1NP_599226.1 PROF 15..119 CDD:294086 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1755
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.