DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chic and pfn4

DIOPT Version :9

Sequence 1:NP_001245905.1 Gene:chic / 33834 FlyBaseID:FBgn0000308 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_002936025.1 Gene:pfn4 / 100495970 XenbaseID:XB-GENE-953486 Length:128 Species:Xenopus tropicalis


Alignment Length:118 Identity:26/118 - (22%)
Similarity:50/118 - (42%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDYVDNQLLASQCV-TKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQR 67
            |:.:.:.|:.:|.| ..|.|...:|.::.....|:|..:.:..::..|.....|...|:.|..:.
 Frog     5 QNLLYDSLIKTQHVEAAALIRIKEGAVFPSPPRFQVQPQIMKTIVDAFKNPSALRKEGLQLWDKS 69

  Fly    68 YIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY 120
            |..:......:.||....|:..:||...::::.|.|.:.|.......|.||.|
 Frog    70 YHCVRADKNSIYAKCDDGGLVLVKTKSNILLATYRDGMYPSVCVEAAETLGSY 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chicNP_001245905.1 PROF 1..126 CDD:214646 26/118 (22%)
pfn4XP_002936025.1 Profilin 5..125 CDD:365966 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12306
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 41 1.000 Inparanoid score I5310
OMA 1 1.010 - - QHG53820
OrthoDB 1 1.010 - - D1428600at2759
OrthoFinder 1 1.000 - - FOG0002709
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.