DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and SLC25A27

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_004268.3 Gene:SLC25A27 / 9481 HGNCID:21065 Length:323 Species:Homo sapiens


Alignment Length:321 Identity:143/321 - (44%)
Similarity:211/321 - (65%) Gaps:11/321 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEKERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIA-SRVG----QK 77
            ||:||    .|...::.|....:|.:..:|..||:..:|.|:.|||:|:|||.| :|:|    :.
Human     5 EEEER----LLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGDGARES 65

  Fly    78 AKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFL 142
            |.|||::.||:||:.|||.|||:.|::..::||.::||.:|:||:::||.:....||....|  .
Human    66 APYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPL--W 128

  Fly   143 GSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGT 207
            .|.|.|::||.....|.|||:|:|:||||||:|:|.|:|.|...|..|...|...||:.|||.|.
Human   129 KSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW 193

  Fly   208 VPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMN 272
            |||..|:|||.:||::.||..|.:|:....|.||.....::::.:|:..:||..||||:||||||
Human   194 VPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGLVASILGTPADVIKSRIMN 258

  Fly   273 QPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRG 333
            ||.|:||||:.||.|.|||.:.|:.|||:::||||:|.|:|:.|.|:|||:|:|:||...|
Human   259 QPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRMTPWSMVFWLTYEKIREMSG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 122/278 (44%)
Mito_carr 32..129 CDD:278578 41/101 (41%)
Mito_carr 138..233 CDD:278578 44/94 (47%)
Mito_carr 246..331 CDD:278578 46/84 (55%)
SLC25A27NP_004268.3 Mito_carr 20..118 CDD:365909 40/97 (41%)
Solcar 1 21..115 39/93 (42%)
Mito_carr 125..219 CDD:365909 44/95 (46%)
Solcar 2 125..217 44/93 (47%)
Solcar 3 226..317 48/90 (53%)
Mito_carr 227..317 CDD:365909 47/89 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3722
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.