DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and SLC25A14

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens


Alignment Length:319 Identity:103/319 - (32%)
Similarity:169/319 - (52%) Gaps:53/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFS 114
            ||...:|.|:.|||:|:||:......::.||||:......|.:|||:|.||.||:..|.|.:.:.
Human    51 AEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYG 115

  Fly   115 GIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRG 179
            .||:..|..::...:...||.    :.|.:.|.||::|..:|.:.|||:::||:||.:|. ..:|
Human   116 TIKIGIYQSLKRLFVERLEDE----TLLINMICGVVSGVISSTIANPTDVLKIRMQAQGS-LFQG 175

  Fly   180 EPPRIHNVLQALTSIYRTGGVVGLWK-------------------------------GTVPNTWR 213
                  :::.:...||:..|..|||:                               |.||...|
Human   176 ------SMIGSFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANAGGSLEGVVPTAQR 234

  Fly   214 SALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQ 278
            :|:|...::..||..|:.||....:.|.....||::.|.|:|.|:.|.|.|||::|:|||     
Human   235 AAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQ----- 294

  Fly   279 GRGI--H---YKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFR 332
             |.|  |   |||::|.:.::.:.|||.|:||||.|.|:|:||.:::|::|:||::|.:
Human   295 -RAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 90/291 (31%)
Mito_carr 32..129 CDD:278578 28/78 (36%)
Mito_carr 138..233 CDD:278578 30/125 (24%)
Mito_carr 246..331 CDD:278578 39/89 (44%)
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 28/81 (35%)
PTZ00169 41..351 CDD:240302 102/316 (32%)
Mito_carr 134..254 CDD:278578 32/130 (25%)
Mito_carr 262..351 CDD:278578 39/94 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.