DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and SFC1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_012629.1 Gene:SFC1 / 853558 SGDID:S000003856 Length:322 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:83/292 - (28%)
Similarity:139/292 - (47%) Gaps:19/292 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLF 108
            |.:.|.     :|.|..|.||||...:|..  :..|..|.:.|...|.::||.|.||.|:.|::.
Yeast    23 FEALCC-----HPLDTIKVRMQIYRRVAGI--EHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVI 80

  Fly   109 RHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVL-TNPTELIKIQMQME 172
            .......|:..:|::.| .::|..|.|  .:|...:.::||.||.|.:|| .||.|::||::|  
Yeast    81 GIIPKMAIRFSSYEFYR-TLLVNKESG--IVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQ-- 140

  Fly   173 GQRRLRGEP---PRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFL-- 232
            .|.....||   |:.:|.:.|..:|.:..||..|::|......|.|.....:.:.|...|.||  
Yeast   141 AQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQN 205

  Fly   233 IAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVRE 297
            ..:.|::.:.|...: .:.:|......:.|.|.:|:|:....:....:....|..:...::|::|
Yeast   206 YHQMDVLPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKE 269

  Fly   298 EGFLAMYKGFIPYWMRVGPASVVFWMTFEQIR 329
            |||.|:|||..|..|||.|...|.:..:|.:|
Yeast   270 EGFRALYKGITPRVMRVAPGQAVTFTVYEYVR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 73/267 (27%)
Mito_carr 32..129 CDD:278578 24/84 (29%)
Mito_carr 138..233 CDD:278578 31/100 (31%)
Mito_carr 246..331 CDD:278578 23/84 (27%)
SFC1NP_012629.1 Mito_carr 6..103 CDD:395101 25/87 (29%)
Mito_carr 108..206 CDD:395101 31/99 (31%)
Mito_carr 210..304 CDD:395101 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.