DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a14

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006257593.1 Gene:Slc25a14 / 85263 RGDID:621433 Length:344 Species:Rattus norvegicus


Alignment Length:334 Identity:113/334 - (33%)
Similarity:187/334 - (55%) Gaps:28/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVFRPAEWDNSEEKERPK---LEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQG 68
            ||...|...::|.::..|   |.:.::.....|   ::....::..||...:|.|:.|||:|:||
  Rat    30 TVVASASQSSAELEQHQKSSALSHEMSGLNWKP---FVYGGLASIVAEFGTFPVDLTKTRLQVQG 91

  Fly    69 EIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDE 133
            :......::.||||:......|.||||:|.||.||:..|.|.:.:..||:..|..::...:...|
  Rat    92 QSIDVRFKEIKYRGMFHALFRIYREEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLE 156

  Fly   134 DGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTG 198
            |.    :.|.:.|.||::|..:|.:.|||:::||:||.:|. ..:|      :::.:...||:..
  Rat   157 DE----TLLINMICGVVSGVISSTIANPTDVLKIRMQAQGS-LFQG------SMIGSFIDIYQQE 210

  Fly   199 GVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPA 263
            |..|||:|.||...|:|:|...::..||..|:.||....|.|.....||::.|.|:|.|:.|.|.
  Rat   211 GTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPV 275

  Fly   264 DVVKSRIMNQPTDEQGRGI--H---YKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWM 323
            |||::|:|||      |.|  |   |||:||.:.::.:.|||.|:||||.|.|:|:||.:::|::
  Rat   276 DVVRTRMMNQ------RAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFI 334

  Fly   324 TFEQIRRFR 332
            |:||::|.:
  Rat   335 TYEQLKRLQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 94/278 (34%)
Mito_carr 32..129 CDD:278578 30/96 (31%)
Mito_carr 138..233 CDD:278578 30/94 (32%)
Mito_carr 246..331 CDD:278578 40/89 (45%)
Slc25a14XP_006257593.1 PTZ00169 63..342 CDD:240302 105/295 (36%)
Mito_carr 253..342 CDD:395101 40/94 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.