DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a27

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:314 Identity:134/314 - (42%)
Similarity:200/314 - (63%) Gaps:14/314 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEKERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIA-SRVG----QK 77
            ||..:|      ..::.|....:|.:..:|..||:..:|.|:.|||:|:|||.| :::|    :.
  Rat     6 EESLQP------LTQRWPRTSKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMES 64

  Fly    78 AKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFL 142
            |.|||::.||:|||:|||.|||:.|::..::||.::||.:|:||:::||.:....||....|  .
  Rat    65 APYRGMMRTALGIVQEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPL--W 127

  Fly   143 GSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGT 207
            .|.|.|::||.....|.|||:|:|:||||||:|||.|:|.|...|..|...|...||:.|||.|.
  Rat   128 KSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRRLEGKPLRFRGVHHAFAKILAEGGIRGLWAGW 192

  Fly   208 VPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMN 272
            :||..|:|||.:||::.||..|.:|:....|.||.....::::.:|:..:||..||||:||||||
  Rat   193 IPNIQRAALVNMGDLTTYDTVKHYLVLNTALEDNIATHGLSSLCSGLVASILGTPADVIKSRIMN 257

  Fly   273 QPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMR-VGPASVVFWMTF 325
            ||.|:||||:.||.|.||:.:.|:.||||::||||:|.|:| |......|::.|
  Rat   258 QPRDKQGRGLLYKSSTDCVIQAVQGEGFLSLYKGFLPSWLRMVKTGRFCFFLCF 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 122/278 (44%)
Mito_carr 32..129 CDD:278578 41/101 (41%)
Mito_carr 138..233 CDD:278578 44/94 (47%)
Mito_carr 246..331 CDD:278578 40/81 (49%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 40/98 (41%)
Mito_carr 122..218 CDD:278578 44/97 (45%)
Mito_carr 224..311 CDD:278578 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352854
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3722
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.