DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CTP1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_009850.1 Gene:CTP1 / 852594 SGDID:S000000495 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:309 Identity:74/309 - (23%)
Similarity:142/309 - (45%) Gaps:30/309 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREE 94
            |.....|:..:|....:..:...:.|||:..|||:|:..: ||:..     |..|.......:.:
Yeast     6 TKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDK-ASKAS-----RNPLVLIYKTAKTQ 64

  Fly    95 GLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASV-L 158
            |:..:|.|..|.:..::..:||:.|.:|.::: |:...|.|  :||.....|:|:.||...|| .
Yeast    65 GIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKD-MLRDSETG--ELSGTRGVIAGLGAGLLESVAA 126

  Fly   159 TNPTELIKIQMQMEGQRRLRGEPPRIHN----VLQALTSIYRTGGVVGLWKGTVPNTWRSALVTI 219
            ..|.|.||..:..:.|    ...|:.||    |::..:|:.|..|..||::|.:|.:.|.|....
Yeast   127 VTPFEAIKTALIDDKQ----SATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQA 187

  Fly   220 GDVSCYDFCKRFLIAEF-----DLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQG 279
            ..:.||:..|. ||.::     |...:..:.|:....:|:.....::|.|.||:|:.:..:.:  
Yeast   188 VRLGCYNKIKT-LIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTK-- 249

  Fly   280 RGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQI 328
                |..:::|.:.:.:|||....:||..|...|:..:..:.:..:|::
Yeast   250 ----YSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 68/283 (24%)
Mito_carr 32..129 CDD:278578 21/96 (22%)
Mito_carr 138..233 CDD:278578 29/99 (29%)
Mito_carr 246..331 CDD:278578 17/83 (20%)
CTP1NP_009850.1 Mito_carr 8..101 CDD:395101 22/99 (22%)
Mito_carr 104..203 CDD:395101 32/105 (30%)
Mito_carr 210..298 CDD:395101 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.