DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and UCP2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_568894.1 Gene:UCP2 / 836014 AraportID:AT5G58970 Length:305 Species:Arabidopsis thaliana


Alignment Length:318 Identity:98/318 - (30%)
Similarity:166/318 - (52%) Gaps:33/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQK-AKYRGL 83
            |.|.::.:|.|        ...:||| ||.||:...|.|..|.|:|:|.:|.:..|:. .||||.
plant     5 KPRIEISFLET--------FICSAFA-ACFAELCTIPLDTAKVRLQLQRKIPTGDGENLPKYRGS 60

  Fly    84 LATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLG----- 143
            :.|...|.||||:..|:.|:.|.|.|..::.|:::..|:.::..::..|        |:|     
plant    61 IGTLATIAREEGISGLWKGVIAGLHRQCIYGGLRIGLYEPVKTLLVGSD--------FIGDIPLY 117

  Fly   144 -SCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGT 207
             ..::.:|.||.|.::.|||:|:|:::|.|| :...|.|.|....:.|..:|.:..||..||.|.
plant   118 QKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYFTIVKLEGVSALWTGL 181

  Fly   208 VPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMN 272
            .||..|:|:|...:::.||..|..::......|:.....:|.:.||.....:..|.||||||:|.
plant   182 GPNIARNAIVNAAELASYDQIKETIMKIPFFRDSVLTHLLAGLAAGFFAVCIGSPIDVVKSRMMG 246

  Fly   273 QPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            ..|        |:.::||..:.::.||.:|.||||:|.:.|:|..:.:.::|.||:::
plant   247 DST--------YRNTVDCFIKTMKTEGIMAFYKGFLPNFTRLGTWNAIMFLTLEQVKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 85/280 (30%)
Mito_carr 32..129 CDD:278578 32/97 (33%)
Mito_carr 138..233 CDD:278578 32/100 (32%)
Mito_carr 246..331 CDD:278578 28/85 (33%)
UCP2NP_568894.1 PTZ00169 11..296 CDD:240302 96/310 (31%)
Mito_carr 212..300 CDD:395101 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3271
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.