DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and DIC2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_194188.1 Gene:DIC2 / 828559 AraportID:AT4G24570 Length:313 Species:Arabidopsis thaliana


Alignment Length:322 Identity:95/322 - (29%)
Similarity:156/322 - (48%) Gaps:48/322 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRV-------------GQKAKYR------- 81
            ||..:.:..:.||.    :|.|:.|.|:|:.||..|..             ...|.:.       
plant     7 VEGGIASVIAGCST----HPLDLIKVRLQLHGEAPSTTTVTLLRPALAFPNSSPAAFLETTSSVP 67

  Fly    82 --GLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLS-FLG 143
              |.::..:.||:.||...|:.|:||.|.|.:|:|..:|..|:.::.|...| |.|:..|| .:|
plant    68 KVGPISLGINIVKSEGAAALFSGVSATLLRQTLYSTTRMGLYEVLKNKWTDP-ESGKLNLSRKIG 131

  Fly   144 SCISGVLAGATASVLTNPTELIKIQMQMEG-----QRRLRGEPPRIHNVLQALTSIYRTGGVVGL 203
               :|::||...:.:.||.::..::||.:|     |||      ....|..|:.|:.:..||..|
plant   132 ---AGLVAGGIGAAVGNPADVAMVRMQADGRLPLAQRR------NYAGVGDAIRSMVKGEGVTSL 187

  Fly   204 WKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKS 268
            |:|:.....|:.:||...::.||..|..::....:.|......||:..||...::.|.|.||:|:
plant   188 WRGSALTINRAMIVTAAQLASYDQFKEGILENGVMNDGLGTHVVASFAAGFVASVASNPVDVIKT 252

  Fly   269 RIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            |:||.....      |.|:.||..:.|:.||.:|:||||:|...|.||.:||.::|.||:|:
plant   253 RVMNMKVGA------YDGAWDCAVKTVKAEGAMALYKGFVPTVCRQGPFTVVLFVTLEQVRK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 82/296 (28%)
Mito_carr 32..129 CDD:278578 29/113 (26%)
Mito_carr 138..233 CDD:278578 28/100 (28%)
Mito_carr 246..331 CDD:278578 34/85 (40%)
DIC2NP_194188.1 Mito_carr 3..118 CDD:395101 29/114 (25%)
Mito_carr 122..220 CDD:395101 29/106 (27%)
Mito_carr 225..312 CDD:395101 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.