DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and AT4G03115

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:332 Identity:88/332 - (26%)
Similarity:157/332 - (47%) Gaps:50/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DNSEEKERPKLEYLVTNKKTPPVELYLTAFA----SACSAEIVGYPFDMCKTRMQIQGEIASRVG 75
            :.:||..:|:       ...||....::.|.    |...|..|.:|.|:.|.|:|:|     .||
plant    48 EGNEELRKPQ-------NLIPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQ-----HVG 100

  Fly    76 QKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLS 140
            |:....|:....:.:::.||...||.|::..|.|..|:.|:::..|:             ..::|
plant   101 QRGPLIGMTGIFLQLMKNEGRRSLYLGLTPALTRSVLYGGLRLGLYE-------------PTKVS 152

  Fly   141 F---------LGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYR 196
            |         |....||..|||.::.||||.|::|:::||        .|..:  .:..:..|..
plant   153 FDWAFGSTNVLVKIASGAFAGAFSTALTNPVEVVKVRLQM--------NPNAV--PIAEVREIVS 207

  Fly   197 TGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSL 261
            ..|:..||||..|...|:|.:|...::.||..||.|:....|.:...:...:::.||:...:::.
plant   208 KEGIGALWKGVGPAMVRAAALTASQLATYDEAKRILVKRTSLEEGFHLHLCSSVVAGLVSTLITA 272

  Fly   262 PADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFE 326
            |.|::|:|:|.|...|..:  .|:....|..::||:||.||:|||....:.|:||.:::.::..|
plant   273 PMDMIKTRLMLQQGSESTK--TYRNGFHCGYKVVRKEGPLALYKGGFAIFARLGPQTMITFILCE 335

  Fly   327 QIRRFRG 333
            ::|...|
plant   336 KLRSLAG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 77/286 (27%)
Mito_carr 32..129 CDD:278578 26/100 (26%)
Mito_carr 138..233 CDD:278578 31/103 (30%)
Mito_carr 246..331 CDD:278578 25/84 (30%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.