DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and UCP5

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_179836.1 Gene:UCP5 / 816783 AraportID:AT2G22500 Length:313 Species:Arabidopsis thaliana


Alignment Length:309 Identity:97/309 - (31%)
Similarity:159/309 - (51%) Gaps:24/309 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFASACSAEIVG----YPFDMCKTRMQIQGEIA---------------SRVGQKAKYRGLLAT 86
            |..||....|.||.    :|.|:.|.|||:|||.|               :.|.......|::..
plant     3 LKGFAEGGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPLRVGVIGV 67

  Fly    87 AMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLA 151
            ...::||||:..|:.|:||.:.|.:|:|..:|..||.::.:...|:....|.:..:|   :|.:|
plant    68 GSRLIREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWTDPETKTMPLMKKIG---AGAIA 129

  Fly   152 GATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSAL 216
            ||..:.:.||.::..::||.:|:..|. :.....:||.|:|.:.|..||..||:|:.....|:.|
plant   130 GAIGAAVGNPADVAMVRMQADGRLPLT-DRRNYKSVLDAITQMIRGEGVTSLWRGSSLTINRAML 193

  Fly   217 VTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRG 281
            ||...::.||..|..::.:..|.|.......|:..||...::.|.|.||:|:|:||... ..|..
plant   194 VTSSQLASYDSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPVDVIKTRVMNMKV-VAGVA 257

  Fly   282 IHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            ..|||::||..:.|:.||.:::||||||...|..|.:||.::|.||:::
plant   258 PPYKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVTLEQVKK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 85/283 (30%)
Mito_carr 32..129 CDD:278578 32/106 (30%)
Mito_carr 138..233 CDD:278578 28/94 (30%)
Mito_carr 246..331 CDD:278578 33/85 (39%)
UCP5NP_179836.1 Mito_carr 3..106 CDD:395101 32/102 (31%)
Mito_carr <136..213 CDD:395101 23/77 (30%)
Mito_carr 216..311 CDD:395101 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.