DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and ucp3

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956647.2 Gene:ucp3 / 794081 ZFINID:ZDB-GENE-040426-1317 Length:309 Species:Danio rerio


Alignment Length:300 Identity:105/300 - (35%)
Similarity:163/300 - (54%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PPVEL--YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKA-KYRGLLATAMGIVREEGL 96
            ||...  :..|..:||.|::|.:|.|..|.|:|||||..:..|... ||||:..|...:||.||.
Zfish    10 PPTAAVKFFGAGTAACFADLVTFPLDTAKVRLQIQGESGTAPGSAVLKYRGVFGTITTMVRTEGA 74

  Fly    97 LKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNP 161
            ..||.|:.|.|.|...|:.:::..||.|::......|:.......|..|.:|.:|.|.|    .|
Zfish    75 RSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGSENASIVTRLLAGCTTGAMAVAFA----QP 135

  Fly   162 TELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYD 226
            |:::|::.|.:.:....|:  |.:..:.|..:|.|..||.|||||.:||..|:|:|...::..||
Zfish   136 TDVVKVRFQAQVRHTDGGK--RYNGTMDAYRTIARDEGVRGLWKGCMPNITRNAIVNCAELVTYD 198

  Fly   227 FCKRFLIAEFDLV-DNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDC 290
            ..|. ||.::||: ||....|.||..||....|::.|.||||:|.||....:      |..:|:|
Zfish   199 IIKD-LILKYDLMTDNLPCHFTAAFGAGFCTTIVASPVDVVKTRFMNSSAGQ------YGSALNC 256

  Fly   291 LSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            ...::.:||..|.||||:|.::|:|..::|.::::|||:|
Zfish   257 ALMMLTKEGPAAFYKGFMPSFLRLGSWNIVMFVSYEQIKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 94/274 (34%)
Mito_carr 32..129 CDD:278578 36/96 (38%)
Mito_carr 138..233 CDD:278578 30/94 (32%)
Mito_carr 246..331 CDD:278578 31/84 (37%)
ucp3NP_956647.2 Mito_carr 10..110 CDD:278578 36/99 (36%)
PTZ00169 14..298 CDD:240302 102/295 (35%)
Mito_carr 114..207 CDD:278578 32/99 (32%)
Mito_carr 211..301 CDD:278578 33/91 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D382447at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.