DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and UCP2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_024304442.1 Gene:UCP2 / 7351 HGNCID:12518 Length:310 Species:Homo sapiens


Alignment Length:278 Identity:88/278 - (31%)
Similarity:143/278 - (51%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YPFDMCKTRMQIQGEIAS--RVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIK 117
            ||.......:|||||...  |....|:|||::.|.:.:||.||...||.|:.|.|.|...|:.::
Human    33 YPCSYPVLALQIQGESQGPVRATASAQYRGVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVR 97

  Fly   118 MLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPP 182
            :..||.:::..    ..|....|.....::|...||.|..:..||:::|::.|.:.:   .|...
Human    98 IGLYDSVKQFY----TKGSEHASIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQAR---AGGGR 155

  Fly   183 RIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFV 247
            |..:.:.|..:|.|..|..||||||.||..|:|:|...::..||..|..|:....:.|:....|.
Human   156 RYQSTVNAYKTIAREEGFRGLWKGTSPNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFT 220

  Fly   248 AAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWM 312
            :|..||....:::.|.||||:|.||....:      |..:..|...::::||..|.||||:|.::
Human   221 SAFGAGFCTTVIASPVDVVKTRYMNSALGQ------YSSAGHCALTMLQKEGPRAFYKGFMPSFL 279

  Fly   313 RVGPASVVFWMTFEQIRR 330
            |:|..:||.::|:||::|
Human   280 RLGSWNVVMFVTYEQLKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 76/252 (30%)
Mito_carr 32..129 CDD:278578 26/75 (35%)
Mito_carr 138..233 CDD:278578 29/94 (31%)
Mito_carr 246..331 CDD:278578 30/85 (35%)
UCP2XP_024304442.1 Mito_carr <42..112 CDD:332982 24/73 (33%)
Mito_carr 113..207 CDD:278578 30/96 (31%)
Mito_carr 218..300 CDD:278578 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D382447at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.