DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and UCP1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_068605.1 Gene:UCP1 / 7350 HGNCID:12517 Length:307 Species:Homo sapiens


Alignment Length:295 Identity:96/295 - (32%)
Similarity:158/295 - (53%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYG 101
            |:|: :|..:||.|:::.:|.|..|.|:|:|||..:  ....:|:|:|.|...:|:.||.:|||.
Human    15 VQLF-SAGIAACLADVITFPLDTAKVRLQVQGECPT--SSVIRYKGVLGTITAVVKTEGRMKLYS 76

  Fly   102 GISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGS-CISGVLAGATASVLTNPTELI 165
            |:.|.|.|....:.:::..||.::|.:..    |:.....||| .::|:..|..|..:..|||::
Human    77 GLPAGLQRQISSASLRIGLYDTVQEFLTA----GKETAPSLGSKILAGLTTGGVAVFIGQPTEVV 137

  Fly   166 KIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKR 230
            |:::|  .|..|.|..||......|...|..|.|:.||||||.||..||.::...::..||..|.
Human   138 KVRLQ--AQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKE 200

  Fly   231 FLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLV 295
            ..:....|.|:.....|:|:.||.....:|.|.||||:|.:|.|..:      ||...:|..::.
Human   201 AFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQ------YKSVPNCAMKVF 259

  Fly   296 REEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            ..||..|.:||.:|.::|:|..:|:.::.|||::|
Human   260 TNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 86/269 (32%)
Mito_carr 32..129 CDD:278578 31/91 (34%)
Mito_carr 138..233 CDD:278578 33/95 (35%)
Mito_carr 246..331 CDD:278578 29/85 (34%)
UCP1NP_068605.1 Mito_carr 10..104 CDD:278578 31/91 (34%)
Solcar 1 11..102 30/89 (34%)
Mito_carr 111..206 CDD:278578 33/96 (34%)
Solcar 2 111..201 33/91 (36%)
Solcar 3 210..295 30/91 (33%)
Mito_carr 215..300 CDD:278578 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D382447at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.