DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a35

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_082324.1 Gene:Slc25a35 / 71998 MGIID:1919248 Length:300 Species:Mus musculus


Alignment Length:299 Identity:94/299 - (31%)
Similarity:154/299 - (51%) Gaps:14/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGIS 104
            :|.:..:||.|.:...|.::.|||||:|||:.:....:..||.:......|.:.:||..|..|:.
Mouse     3 FLMSGVAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFFTIGKVDGLAALQKGLG 67

  Fly   105 AMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQM 169
            ..|....|.:||::.||.....:..:...:|..  |.:.|..:|.|||...:.|.:|..::|..:
Mouse    68 PALLYQFLMNGIRLGTYGLAESRGYLHTNEGTH--SPVRSAAAGALAGVMGAYLGSPIYMVKTHL 130

  Fly   170 QMEGQRRLR-GEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCK---- 229
            |.:....:. |...:...:.||||.|.:..|:||||:|.|....|   |.||  |....|.    
Mouse   131 QAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGAVGGLPR---VVIG--SSTQLCTFSSI 190

  Fly   230 RFLIAEFDLV--DNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLS 292
            :.|::::::.  .:.:|...|||.:|||..:...|.||..:|:.|||||.:|:|:.|:|.||.|.
Mouse   191 KDLLSQWEIFPPQSWKVALAAAMVSGVAIVVAMTPFDVASTRLYNQPTDTRGKGLMYRGILDALL 255

  Fly   293 RLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331
            :..|.|||..||||....:.|:||.:::....::|:|.|
Mouse   256 QTARTEGFFGMYKGIGASYFRLGPHTILSLFFWDQLRSF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 86/272 (32%)
Mito_carr 32..129 CDD:278578 26/88 (30%)
Mito_carr 138..233 CDD:278578 29/99 (29%)
Mito_carr 246..331 CDD:278578 35/84 (42%)
Slc25a35NP_082324.1 Solcar 1 1..90 26/86 (30%)
Mito_carr 2..84 CDD:365909 24/80 (30%)
Solcar 2 100..193 29/99 (29%)
Mito_carr 101..194 CDD:365909 29/97 (30%)
Solcar 3 203..294 36/90 (40%)
Mito_carr 209..297 CDD:365909 36/86 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.