DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a11

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_071793.2 Gene:Slc25a11 / 64201 RGDID:708476 Length:314 Species:Rattus norvegicus


Alignment Length:304 Identity:99/304 - (32%)
Similarity:155/304 - (50%) Gaps:20/304 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGL 96
            :.:|....:|....:...|.:...|.|:.|.|||:.||.|.....|..:..|.:    |::.|||
  Rat    17 RTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTS----ILKAEGL 77

  Fly    97 LKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNP 161
            ..:|.|:||.|.|.:.::..::..|..:.|::  ...||.|. .||...:.|:.||||.:.:..|
  Rat    78 RGIYTGLSAGLLRQATYTTTRLGIYTVLFERL--TGADGTPP-GFLLKALIGMTAGATGAFVGTP 139

  Fly   162 TELIKIQMQMEGQRRLRGEPPR-IHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCY 225
            .|:..|:|..:|  ||..:..| ..||..||..|.|..||..||:|.:|...|:.:|....::.|
  Rat   140 AEVALIRMTADG--RLPADQRRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASY 202

  Fly   226 DFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGI----HYKG 286
            ...|:||:......||....|.|:|.:|:.....|:|.|:||:||.|.      |.|    .||.
  Rat   203 SQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNM------RMIDGKPEYKN 261

  Fly   287 SLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            .||.|.::||.|||.:::|||.||:.|:||.:|:.::..||:.:
  Rat   262 GLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 88/278 (32%)
Mito_carr 32..129 CDD:278578 26/96 (27%)
Mito_carr 138..233 CDD:278578 32/95 (34%)
Mito_carr 246..331 CDD:278578 35/89 (39%)
Slc25a11NP_071793.2 Solcar 1 23..108 24/88 (27%)
Mito_carr 24..102 CDD:395101 23/81 (28%)
Mito_carr 116..213 CDD:395101 34/99 (34%)
Solcar 2 117..208 31/93 (33%)
Mito_carr 215..313 CDD:395101 37/97 (38%)
Solcar 3 217..306 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.