DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and rangrf

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002941865.3 Gene:rangrf / 496602 XenbaseID:XB-GENE-5760490 Length:238 Species:Xenopus tropicalis


Alignment Length:67 Identity:15/67 - (22%)
Similarity:26/67 - (38%) Gaps:4/67 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTVFRPAEWDNSEEKERPKLEYLVTNKKTPP---VELYLTAFASACSAEIVGYPFDMCKTRMQIQ 67
            :.|..|...|.||.:|.|..:.:..:..|..   ||| |........::...|.|:...:....:
 Frog    65 SAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVEL-LEYQEGVSDSDAARYHFEDVASSNDAE 128

  Fly    68 GE 69
            |:
 Frog   129 GQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 8/41 (20%)
Mito_carr 32..129 CDD:278578 8/41 (20%)
Mito_carr 138..233 CDD:278578
Mito_carr 246..331 CDD:278578
rangrfXP_002941865.3 Mog1 58..238 CDD:238137 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.