powered by:
Protein Alignment Ucp4B and rangrf
DIOPT Version :9
Sequence 1: | NP_608977.1 |
Gene: | Ucp4B / 33833 |
FlyBaseID: | FBgn0031758 |
Length: | 337 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941865.3 |
Gene: | rangrf / 496602 |
XenbaseID: | XB-GENE-5760490 |
Length: | 238 |
Species: | Xenopus tropicalis |
Alignment Length: | 67 |
Identity: | 15/67 - (22%) |
Similarity: | 26/67 - (38%) |
Gaps: | 4/67 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 NTVFRPAEWDNSEEKERPKLEYLVTNKKTPP---VELYLTAFASACSAEIVGYPFDMCKTRMQIQ 67
:.|..|...|.||.:|.|..:.:..:..|.. ||| |........::...|.|:...:....:
Frog 65 SAVLPPFSQDVSELREIPDNQEVFAHNATDQSIIVEL-LEYQEGVSDSDAARYHFEDVASSNDAE 128
Fly 68 GE 69
|:
Frog 129 GQ 130
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG54059 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.