DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and aralar1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:311 Identity:94/311 - (30%)
Similarity:145/311 - (46%) Gaps:37/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISA 105
            |.:||.|..|.:| ||.|:.|||||.| ...|.:|:.| ||........:||.||.:.||.|:..
  Fly   360 LGSFAGAVGATVV-YPIDLVKTRMQNQ-RAGSYIGEVA-YRNSWDCFKKVVRHEGFMGLYRGLLP 421

  Fly   106 MLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQ 170
            .|...:....||:...|.:|:|:    .|.:..:......::|..|||:..|.|||.|::||::|
  Fly   422 QLMGVAPEKAIKLTVNDLVRDKL----TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQ 482

  Fly   171 MEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDF----CKRF 231
            :.|: ...|...|..:|::.|       |:.||:||.     |:.|:.....|...|    ..:.
  Fly   483 VAGE-IASGSKIRAWSVVREL-------GLFGLYKGA-----RACLLRDVPFSAIYFPTYAHTKA 534

  Fly   232 LIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVR 296
            ::|:.|..::......|...|||..|.|..||||:|:|:  |.....|: ..|.|..|...:::.
  Fly   535 MMADKDGYNHPLTLLAAGAIAGVPAASLVTPADVIKTRL--QVVARSGQ-TTYTGVWDATKKIMA 596

  Fly   297 EEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF----------RGSEGY 337
            |||..|.:||......|..|...|..:|:|.::|.          :|||.:
  Fly   597 EEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVDFGGTQPKGSEAH 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 83/268 (31%)
Mito_carr 32..129 CDD:278578 33/87 (38%)
Mito_carr 138..233 CDD:278578 26/98 (27%)
Mito_carr 246..331 CDD:278578 28/84 (33%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 34/94 (36%)
PTZ00169 358..631 CDD:240302 90/293 (31%)
Mito_carr 449..539 CDD:278578 27/102 (26%)
Mito_carr 544..633 CDD:278578 29/91 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.