DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG4743

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:293 Identity:69/293 - (23%)
Similarity:118/293 - (40%) Gaps:51/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSG 115
            :|..:|.|..|||:|.:.......|.:..|:||...|.|           ...:|.||       
  Fly    42 DIALFPIDTVKTRLQSELGFWRAGGFRGIYKGLAPAAAG-----------SAPTAALF------- 88

  Fly   116 IKMLTYDYMRE--KMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQ-MEGQRRL 177
              ..||:..::  ..:...:|. |.:....:..:.||    |.::..|.|:.|.:.| ::|.:: 
  Fly    89 --FCTYECGKQFLSSVTQTKDS-PYVHMAAASAAEVL----ACLIRVPVEIAKQRSQTLQGNKQ- 145

  Fly   178 RGEPPRIHNVLQALTSIYRTGGVV-GLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDN 241
                    :.||.|...|||.|:. ||::|......|....::.....:::   |.:....|...
  Fly   146 --------SGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWEY---FKLQWTPLTGF 199

  Fly   242 REVQFVAAMTAGVADAI---LSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAM 303
            ....|..|:...||..|   |:.|.||||:|||....:...|   .:.:...|..:..|.||..:
  Fly   200 DSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNR---RRSARRILHGIYLERGFSGL 261

  Fly   304 YKGFIP--YWMRVGPASVVFWMTFEQIRRFRGS 334
            :.||:|  .|:.:|.|  .|:..::...|..|:
  Fly   262 FAGFVPRVLWITLGGA--FFFGFYDLTTRILGA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 60/261 (23%)
Mito_carr 32..129 CDD:278578 18/79 (23%)
Mito_carr 138..233 CDD:278578 20/96 (21%)
Mito_carr 246..331 CDD:278578 26/89 (29%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 18/76 (24%)
PTZ00168 25..281 CDD:185494 67/280 (24%)
Mito_carr 199..291 CDD:278578 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.