DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG5805

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:361 Identity:86/361 - (23%)
Similarity:141/361 - (39%) Gaps:84/361 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TVFRPAEWDNSEEKERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIA 71
            |..|..|||            ::...|..|:.: |::|:..|..    :|..:.||::|:|.:  
  Fly    27 TYIRTIEWD------------MMNKTKFFPLSM-LSSFSVRCCL----FPLTVIKTQLQVQHK-- 72

  Fly    72 SRVGQKAKYRGLLATAMGIVREEGLLKLYGG--ISAMLFRHSLFSGIKML-TYDYMREKMIVPDE 133
            |.|     |:|::..||.|.|.||:..||.|  ||::    .:.||:..: ||:.:|.  ::.|.
  Fly    73 SDV-----YKGMVDCAMKIYRSEGVPGLYRGFWISSV----QIVSGVFYISTYEGVRH--VLNDL 126

  Fly   134 DGRPQLSFL--GSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEP--------------P 182
            ....::..|  |.|.|  |.|.|..|   |.::|.....:.|.....|..              .
  Fly   127 GAGHRMKALAGGGCAS--LVGQTIIV---PFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRS 186

  Fly   183 RIHNVLQALTSIYRTGGVVGLWKG-------TVPNT---WRSALVTIGDVSCYDFCKRFLIAEFD 237
            |:|..:.....|.|..|..|.::|       .|||:   |  |...:.....:..|..:      
  Fly   187 RLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWW--AFYHLYQDELFRICPVW------ 243

  Fly   238 LVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSR-LVREEGFL 301
             |.:..:|.||....|....||:.|.|:|::|:.          :|...|:....| |.:||...
  Fly   244 -VSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQ----------VHRLDSMSVAFRELWQEEKLN 297

  Fly   302 AMYKGFIPYWMRVGPASVVFWMTFEQIRRFRGSEGY 337
            ..:||.....::....|....:.:|.|:|....|.|
  Fly   298 CFFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 73/303 (24%)
Mito_carr 32..129 CDD:278578 30/99 (30%)
Mito_carr 138..233 CDD:278578 25/120 (21%)
Mito_carr 246..331 CDD:278578 20/85 (24%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 28/96 (29%)
Mito_carr 132..238 CDD:395101 24/112 (21%)
Mito_carr 245..327 CDD:395101 21/91 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.