DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and slc25a11

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001002099.1 Gene:slc25a11 / 415189 ZFINID:ZDB-GENE-040625-79 Length:308 Species:Danio rerio


Alignment Length:302 Identity:98/302 - (32%)
Similarity:159/302 - (52%) Gaps:15/302 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTPPVEL-YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAK-YRGLLATAMGIVREEG 95
            ||.|..: :|....:...|.:...|.|:.|.|||:.|:     |.||: |:........|:|.||
Zfish    11 KTSPKSIKFLFGGLAGMGATVFVQPLDLVKNRMQLSGQ-----GSKAREYKTSFHAVGSILRNEG 70

  Fly    96 LLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTN 160
            :..:|.|:||.|.|.:.::..::..|..:.|:|  ...||.|...|:.:.| |:.||||.:.:..
Zfish    71 VRGIYTGLSAGLLRQATYTTTRLGIYTILFERM--SKADGTPPNFFMKALI-GMTAGATGAFVGT 132

  Fly   161 PTELIKIQMQMEGQRRLRGEPPRIH-NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSC 224
            |.|:..|:|..:|  ||..:..|.: ||..||..|.|..||..||:|.:|...|:.:|....::.
Zfish   133 PAEVALIRMTADG--RLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQLAS 195

  Fly   225 YDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLD 289
            |...|:.|:......|:....|.|:|.:|:.....|:|.|:||:||.|....: |:. .|...||
Zfish   196 YSQSKQALLDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMID-GKP-EYNNGLD 258

  Fly   290 CLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331
            .|.:::|.|||.:::|||.||:.|:||.:|:.::..||:.:|
Zfish   259 VLVKVIRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKF 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 86/275 (31%)
Mito_carr 32..129 CDD:278578 28/97 (29%)
Mito_carr 138..233 CDD:278578 31/95 (33%)
Mito_carr 246..331 CDD:278578 32/84 (38%)
slc25a11NP_001002099.1 Mito_carr 18..96 CDD:278578 23/82 (28%)
PTZ00169 19..300 CDD:240302 94/292 (32%)
Mito_carr 110..207 CDD:278578 33/99 (33%)
Mito_carr 213..305 CDD:278578 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.