DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and GC1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:304 Identity:81/304 - (26%)
Similarity:130/304 - (42%) Gaps:55/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 AEIVG----YPFDMCKTRMQIQGEIASRVGQKAK--YRGLLATAMGIVREEGLLKLYGGISAMLF 108
            |.|:|    :|.|:.|||:|.|     ::|...:  |..:........:.||...:|.|....:.
  Fly    31 AGIIGVTCVFPLDLVKTRLQNQ-----QIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNIL 90

  Fly   109 RHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEG 173
            ..:....||:...||.|.|:..  :||:  |......::|.||||...::|.|.||:|||||..|
  Fly    91 LITPEKAIKLTANDYFRHKLTT--KDGK--LPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAG 151

  Fly   174 Q----RRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIA 234
            :    .:|.|:.....:..|..:.:.:..|:.||:||            ||.....|.  .|.|.
  Fly   152 RVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKG------------IGATGLRDV--TFSII 202

  Fly   235 EF-------DLVDNRE---------VQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIH 283
            .|       ||...|.         ..|:|.:.||...|:...|.||||:|:  |...:......
  Fly   203 YFPLFATLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRL--QAIKKADGEKE 265

  Fly   284 YKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGP----ASVVFWM 323
            :||..||:::.::.||..|.:||.:...:.:.|    |..|:::
  Fly   266 FKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTVYYL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 76/281 (27%)
Mito_carr 32..129 CDD:278578 22/84 (26%)
Mito_carr 138..233 CDD:278578 28/98 (29%)
Mito_carr 246..331 CDD:278578 24/82 (29%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 19/83 (23%)
Mito_carr 115..213 CDD:278578 31/113 (27%)
Mito_carr 226..307 CDD:278578 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.