DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG16736

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:296 Identity:66/296 - (22%)
Similarity:117/296 - (39%) Gaps:50/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLF 113
            :|:::.:|.::.:..||......||:.....:|        ::...||...|.||.|...|.::.
  Fly    12 TAQLLSHPMELVRVNMQANVIHHSRLSINHMFR--------LMARHGLPGFYYGIVAACLRCTVH 68

  Fly   114 SGIKMLTY-------DYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQM 171
            :   |.||       |.....|:.|         :..|.:.|: .|....||..|...:.:..|.
  Fly    69 T---MSTYTLFYNLQDNKYVLMLQP---------YNTSMVLGI-TGFWGGVLATPFAKLAVIRQA 120

  Fly   172 EGQRRLRG--EPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIA 234
            :   ..||  |.....|..:.|..:|..||...|:.|...|:..|..|.:......|.. ..:|:
  Fly   121 D---LTRGSYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKV-HTVIS 181

  Fly   235 EFDLVDNREVQ--FVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHY-KGSLDCLSR-LV 295
            .|..:|...:.  ...|:|..:...|:: |.|.:.:..:|:.:       || :.|...|.| ::
  Fly   182 WFHRLDEPWLSDLITMALTGSIITVIMT-PVDALATLTLNESS-------HYGRTSYPYLYRKII 238

  Fly   296 REEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331
            |:.|:...:.|:.|..|.:.|.:|:  .||  :.||
  Fly   239 RKHGYKGFFFGWKPALMALIPHTVL--ATF--VYRF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 57/269 (21%)
Mito_carr 32..129 CDD:278578 18/86 (21%)
Mito_carr 138..233 CDD:278578 21/96 (22%)
Mito_carr 246..331 CDD:278578 20/86 (23%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/79 (22%)
Mito_carr 187..277 CDD:278578 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441645
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.