DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Mpcp2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:119/287 - (41%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLT 120
            |.|:.|.|:|:         .:|||:.|:......|.|||...|..|....|..:|.....|...
  Fly    82 PLDLVKCRLQV---------DQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGL 137

  Fly   121 YDYMREKM--IVPDEDG---RPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGE 180
            |:..:.|.  |:.:|:.   |..| :|.:..|   |...|.:...|.|..|:::|.        .
  Fly   138 YELFKVKYAEIIGEENAYLYRTSL-YLAASAS---AEFFADIALAPFEAAKVKIQT--------I 190

  Fly   181 PPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLI--------AEFD 237
            |...:|..:|:..:.:..||...:||.||...|....|:...:|::.....|.        |:..
  Fly   191 PGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCT 255

  Fly   238 LVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLA 302
            ..:...|.|.|...|||..|::|.|||||.|: :||.          ||: ..:| :.:..||..
  Fly   256 KGEQLIVTFAAGYIAGVFCAVVSHPADVVVSK-LNQA----------KGA-SAIS-VAKSLGFSG 307

  Fly   303 MYKGFIPYWMRVGPASVVFWMTFEQIR 329
            |:.|..|..:.:|..:.:.|..::.::
  Fly   308 MWNGLTPRIIMIGTLTALQWFIYDGVK 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 68/262 (26%)
Mito_carr 32..129 CDD:278578 20/74 (27%)
Mito_carr 138..233 CDD:278578 21/94 (22%)
Mito_carr 246..331 CDD:278578 25/84 (30%)
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 19/68 (28%)
Mito_carr <175..245 CDD:278578 17/77 (22%)
Mito_carr 260..338 CDD:278578 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.