DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and SCaMC

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:312 Identity:75/312 - (24%)
Similarity:135/312 - (43%) Gaps:50/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 AFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGI-VREEGLLKLYGGISAM 106
            |.:..|:|     |.|..|..:|:|   ..|:|        ::..|.| :.|.|...::.|....
  Fly   297 AVSRTCTA-----PLDRIKVYLQVQ---TQRMG--------ISECMHIMLNEGGSRSMWRGNGIN 345

  Fly   107 LFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQM 171
            :.:.:..:..|...|:.|  |.::..:||..|:|.:....:|..||..:..:..|.|::|.::.:
  Fly   346 VLKIAPETAFKFAAYEQM--KRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLAL 408

  Fly   172 EGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIG-DVSCYDFCKRFLIAE 235
            ....:..|       :..|...||:..||...::|.|||. ...|...| |::.|:..||..||.
  Fly   409 RRTGQYAG-------IADAAVKIYKQEGVRSFYRGYVPNI-LGILPYAGIDLAVYETLKRRYIAN 465

  Fly   236 FDLVDNREVQFVAAMTAGVADAIL----SLPADVVKSRIMNQPTD-----EQGRGIHYKGSLDCL 291
            .|  :|.:..|:..:..|...:.|    |.|..:|::|:..|..:     ::...|..|.| |..
  Fly   466 HD--NNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSS-DAH 527

  Fly   292 S----------RLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRG 333
            |          ::||:||...:|:|..|.:::|.||..:.::.:|...|..|
  Fly   528 SGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALG 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 67/283 (24%)
Mito_carr 32..129 CDD:278578 19/86 (22%)
Mito_carr 138..233 CDD:278578 24/95 (25%)
Mito_carr 246..331 CDD:278578 24/103 (23%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 19/90 (21%)
Mito_carr 375..463 CDD:278578 24/95 (25%)
Mito_carr 470..581 CDD:278578 26/111 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.