DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and slc25a10b

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_957466.1 Gene:slc25a10b / 394147 ZFINID:ZDB-GENE-040426-1095 Length:286 Species:Danio rerio


Alignment Length:299 Identity:82/299 - (27%)
Similarity:143/299 - (47%) Gaps:32/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGIS 104
            |....|| |.|....:|.|:.|..:|.|.|:..|         ::..|:.:|:.:|.|.||.|:|
Zfish    10 YFGGIAS-CGAACCTHPLDLIKVHLQTQQEVKMR---------MMGMAIHVVKNDGFLALYSGLS 64

  Fly   105 AMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQM 169
            |.|.|...:|..:...|:.:|:.:   ....:..:.|....:.|...|.|...:..|.:::.::|
Zfish    65 ASLCRQMSYSLTRFAIYETVRDTL---GSGSQGPMPFYQKVLLGAFGGFTGGFIGTPADMVNVRM 126

  Fly   170 QME-----GQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCK 229
            |.:     .|||      ...:.|..|..::|..|...|:.|....:.|.||||:|.::|||..|
Zfish   127 QNDVKLPLEQRR------NYKHALDGLFRVWREEGTRRLFSGATMASSRGALVTVGQLACYDQAK 185

  Fly   230 RFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRL 294
            :.::....:.||....|:::..||.....|..|.||:|:|:||...:       |:|.:.|||..
Zfish   186 QLVLGTGLMGDNILTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE-------YRGVMHCLSET 243

  Fly   295 VREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRG 333
            .: .|.||.|||.:|..:|:.|.:::.::..||::::.|
Zfish   244 AK-LGPLAFYKGLVPAGIRLIPHTILTFVFLEQLKKYFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 74/270 (27%)
Mito_carr 32..129 CDD:278578 26/88 (30%)
Mito_carr 138..233 CDD:278578 26/99 (26%)
Mito_carr 246..331 CDD:278578 27/84 (32%)
slc25a10bNP_957466.1 PTZ00169 12..278 CDD:240302 80/292 (27%)
Mito_carr 12..92 CDD:278578 25/92 (27%)
Mito_carr <118..190 CDD:278578 22/77 (29%)
Mito_carr 197..281 CDD:278578 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.