DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and slc25a27

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:319 Identity:143/319 - (44%)
Similarity:205/319 - (64%) Gaps:10/319 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVG------QKAKYRGL 83
            :.:|..|.:.|.|..:..:..:|..||:|.:|.|:.|||:|||||  .|.|      |..||||:
Zfish     1 MSHLQENSRWPRVSKFTLSACAAAVAELVTFPLDLTKTRLQIQGE--GRSGKNGGSVQTQKYRGM 63

  Fly    84 LATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISG 148
            |:||.|||||||.|||:.|::..::||.::||.:||.|:.|||.::...|||  ......:.|:.
Zfish    64 LSTAAGIVREEGPLKLWQGVTPAIYRHIVYSGGRMLAYEQMRESVLGKSEDG--IFPVWKAVIAS 126

  Fly   149 VLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWR 213
            :::||....:.:||:|:|:||||||:|||.|:|||:..|..|.|.|...||:.|||.|.|||..|
Zfish   127 MISGALGQFIASPTDLVKVQMQMEGRRRLEGKPPRVRGVYHAFTKIVAQGGIRGLWAGWVPNVQR 191

  Fly   214 SALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQ 278
            :|||.:||:..||..|.||:....:.||.....::::.:|:..|.:..||||||:|:||||.|..
Zfish   192 AALVNLGDLMTYDTVKHFLLRNTSIPDNSICHGLSSICSGLVAATMGTPADVVKTRVMNQPRDSN 256

  Fly   279 GRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRGSEGY 337
            |||:.|:.|.|||.:.||.|||.::||||:|.|.|:.|.|:.||:||||:||..|...:
Zfish   257 GRGLLYRNSTDCLVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQLRRAMGISSF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 124/279 (44%)
Mito_carr 32..129 CDD:278578 47/102 (46%)
Mito_carr 138..233 CDD:278578 43/94 (46%)
Mito_carr 246..331 CDD:278578 43/84 (51%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 46/100 (46%)
PTZ00169 16..310 CDD:240302 138/297 (46%)
Mito_carr 118..213 CDD:278578 44/94 (47%)
Mito_carr 217..311 CDD:278578 46/93 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594808
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3722
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.