DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG18418

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:305 Identity:93/305 - (30%)
Similarity:156/305 - (51%) Gaps:24/305 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KKTPPVEL-YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEG 95
            |||.|..: ::....|...|..:..|.|:.||||||.|.:.:|     :|:........:::.||
  Fly     9 KKTVPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTR-----EYKNSFEVLSKVLKNEG 68

  Fly    96 LLKLYGGISAMLFRHSLFSGIKMLTY----DYMREKMIVPDEDGRPQLSFLGSCISGVLAGATAS 156
            :|.||.|:||.|.|.:.::..||..|    |:.|:..     ...|  |.:.|...|::|||..:
  Fly    69 ILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNF-----GNYP--SMVASMTMGIVAGAFGA 126

  Fly   157 VLTNPTELIKIQMQMEGQRRLRGEPPRIH-NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIG 220
            :..||.|:..|:|..:  .||..|..|.: ||..|...|.:..|||.||:|.:|...|:.:|.:.
  Fly   127 MCGNPAEVALIRMMSD--NRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMV 189

  Fly   221 DVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYK 285
            .::.|...|..|...  |.:...:...||:.:|:..::.|:|.|:.|:||......: |:. .|.
  Fly   190 QLASYSLMKNQLHGY--LSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVID-GKP-EYS 250

  Fly   286 GSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            |::|.|.::::.||..|::|||.||.||:||.::..::..||:.:
  Fly   251 GTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 82/279 (29%)
Mito_carr 32..129 CDD:278578 32/101 (32%)
Mito_carr 138..233 CDD:278578 30/95 (32%)
Mito_carr 246..331 CDD:278578 28/85 (33%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 31/107 (29%)
PTZ00169 18..296 CDD:240302 89/296 (30%)
Mito_carr 109..205 CDD:278578 32/101 (32%)
Mito_carr 208..300 CDD:278578 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.