DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and PMP34

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:306 Identity:66/306 - (21%)
Similarity:129/306 - (42%) Gaps:48/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ASACSAEIVGYPFDMCKTRMQIQ--GEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAML 107
            |..|.|....||.|..::|:|::  |::          |........||..||...||.|:..:|
  Fly    24 AGGCIAMSTFYPLDTVRSRLQLEEAGDV----------RSTRQVIKEIVLGEGFQSLYRGLGPVL 78

  Fly   108 FRHSLFSGIKMLTYDYMREKMIVPDEDGRP-QLSFLGSCISGVLAGATASVLTNPTELIKIQMQM 171
              .||.  |....|.|....:......|.| |.|.|...:.|.:||....:.|.|..::..:::|
  Fly    79 --QSLC--ISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRM 139

  Fly   172 EGQRRLRGEPPRIH----NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVS----CYDFC 228
               |.:.|....::    |:|:.|..:....|:.|||.||:|     :|:.:.:.:    .|:..
  Fly   140 ---RNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIP-----SLMLVSNPALQFMMYEML 196

  Fly   229 K----RFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIM-------NQPTDEQGRGI 282
            |    ||...|   :.:....|:.|:....| .:|:.|..:|:::..       ::|:...|...
  Fly   197 KRNIMRFTGGE---MGSLSFFFIGAIAKAFA-TVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTP 257

  Fly   283 HYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQI 328
            ..:.:|:.:..:::.:|...:::|.....::....:.:.:|.:|:|
  Fly   258 RTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 62/282 (22%)
Mito_carr 32..129 CDD:278578 23/85 (27%)
Mito_carr 138..233 CDD:278578 26/106 (25%)
Mito_carr 246..331 CDD:278578 14/90 (16%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 23/85 (27%)
Mito_carr 105..202 CDD:278578 24/104 (23%)
Mito_carr 214..303 CDD:278578 13/89 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.