DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Tpc2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:305 Identity:74/305 - (24%)
Similarity:129/305 - (42%) Gaps:39/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SACSAEIVGYPFDMCKTRMQIQGE-IASRVGQKAKYRGLLATAMGIVREEGLLKLYGG------- 102
            :..:...:..|.|:.|.|.|:|.| :.:..|  :||||::.....:..|||:..::.|       
  Fly    19 AGAATRTITQPLDVLKIRFQMQVEPVTNHKG--SKYRGVIHAFKSVYAEEGMRGMFRGHNSGQVL 81

  Fly   103 -ISAMLFRHSLFSGIKMLT--YDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTEL 164
             ||..|.:...:..::.:.  :||.||         ||.|.|.   |.|.:||...:|...|.::
  Fly    82 SISYALVQFWSYEQLRSMAHQFDYWRE---------RPFLMFF---ICGGIAGCLGAVAAQPFDV 134

  Fly   165 IKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIG-DVSCYDFC 228
            ::.||........|.:    .|....|..:|:..|.:||.:| :|.|.......:| :...|.:.
  Fly   135 VRTQMVAADPSSRRSQ----MNTFTGLRKVYKMEGWMGLSRG-LPFTLVQVFPLVGANFLFYKYL 194

  Fly   229 KRFLIAEFDLVDNREVQ----FVAAMTAGVADAILSLPADVVKSRI----MNQPTDEQGRGIHYK 285
            ...::........:|:.    |:....:||...::..|||::|.||    ..|.....||.....
  Fly   195 NAAVLMAKPPDQRQEIHGAFLFLNGALSGVLAKMIVYPADLLKKRIQLMAFKQERKTFGRNPECP 259

  Fly   286 GSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            ..|.|::...||||....|||.:|..::.|..|.|::..::..:|
  Fly   260 TILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYDMFKR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 67/279 (24%)
Mito_carr 32..129 CDD:278578 23/93 (25%)
Mito_carr 138..233 CDD:278578 22/95 (23%)
Mito_carr 246..331 CDD:278578 26/89 (29%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 73/299 (24%)
Mito_carr 23..99 CDD:278578 19/77 (25%)
Mito_carr 108..194 CDD:278578 25/102 (25%)
Mito_carr 216..307 CDD:278578 26/89 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.