DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Shawn

DIOPT Version :10

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:237 Identity:46/237 - (19%)
Similarity:78/237 - (32%) Gaps:76/237 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PLEERMQVATQLLDTVPLIDGHNDLPWNIRKFLHNQLNDFRQTILPW---------------SKS 75
            |:..|:|...:...:|.:         :|..|:.....||.:..:.:               ||.
  Fly   128 PMHNRIQKINEKTVSVRI---------SIAVFIFVMFVDFTELAMTYRIKWLPSILFYNNSKSKP 183

  Fly    76 AWSHTDLQRLKRGRISAQVSSLCCSQCISSFDLKYT----YVPCEAQHKDAVQITLEQIDVIKRL 136
            .|.|..|              :.|..|::|..:..:    :|| ...:.....|.:.|:..||: 
  Fly   184 EWQHYVL--------------VDCFSCVTSLQIHISICSRFVP-SLIYPILTTILILQLRTIKK- 232

  Fly   137 TERYSPHLTSCASTFDIMQAHKNRQMCSLIGV-----EGGHSLGGSLGVLRIYYALGVRYMTLTS 196
              |.:..|.|.:|.    |:....:|...:.:     ||   |.|..|.:::|          ..
  Fly   233 --RKANLLKSTSSN----QSDNKFKMILWLTITFMLSEG---LTGFTGWMQLY----------NM 278

  Fly   197 TCHTPWADSSNADAPKYDIRHGGLTAYGKTIVREMNRLGMIV 238
            ..|   .|:|...|     |....|.|....||.:|.|..|:
  Fly   279 NIH---IDTSQKFA-----RFWVSTYYAMFTVRAVNSLSHIL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 Mito_carr 32..129 CDD:395101 17/115 (15%)
Mito_carr 138..233 CDD:395101 21/99 (21%)
Mito_carr 246..331 CDD:395101
ShawnNP_001027071.1 Mito_carr 39..159 CDD:395101 7/39 (18%)
Mito_carr 178..265 CDD:395101 20/108 (19%)
Mito_carr 268..371 CDD:395101 15/63 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.