DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Mpcp1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:305 Identity:71/305 - (23%)
Similarity:120/305 - (39%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISA 105
            |....|..|...:..|.|:.|.|:|:         ..|||:.:.......:.|||:..|..|.:.
  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQV---------DPAKYKSVFTGFRISLAEEGVRGLAKGWAP 135

  Fly   106 MLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATAS------VLTNPTEL 164
            ....:|:....|...|:..  |.:..|..|. :.:||..  :|:...|:||      :...|.|.
  Fly   136 TFIGYSMQGLCKFGLYEVF--KKVYGDAIGE-ENAFLYR--TGLYLAASASAEFFADIALAPMEA 195

  Fly   165 IKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCK 229
            .|:::|.        .|.....:.:||..:....||...:||.||...|....|:...:|::...
  Fly   196 AKVKIQT--------TPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTL 252

  Fly   230 RFLI--------AEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKG 286
            ..|.        |:....:...|.|.|...|||..||:|.|||.|.|::      .|.:|   ..
  Fly   253 ELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL------NQAKG---AS 308

  Fly   287 SLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331
            :||...:|    |:..::.|.:|..:.:|..:...|..::.::.|
  Fly   309 ALDVAKQL----GWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 66/278 (24%)
Mito_carr 32..129 CDD:278578 20/87 (23%)
Mito_carr 138..233 CDD:278578 22/100 (22%)
Mito_carr 246..331 CDD:278578 23/84 (27%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 20/90 (22%)
Mito_carr <188..258 CDD:278578 17/77 (22%)
Mito_carr 273..350 CDD:278578 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.