DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a30

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001013205.1 Gene:Slc25a30 / 361074 RGDID:1359702 Length:291 Species:Rattus norvegicus


Alignment Length:285 Identity:105/285 - (36%)
Similarity:167/285 - (58%) Gaps:11/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRH 110
            ::.:||...:|.|:.|||:||||:......::.:|||:|...|.|.|||||..||.||:..:.|.
  Rat    15 ASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIGREEGLRALYSGIAPAMLRQ 79

  Fly   111 SLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQR 175
            :.:..||:.||..::...:...||.    :.|.:.:.|:|:|..:|.:.|||:::||:||.:...
  Rat    80 ASYGTIKIGTYQSLKRLAVERPEDE----TLLINVVCGILSGVISSAIANPTDVLKIRMQAQNSA 140

  Fly   176 RLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVD 240
            ...|   .|.|.:    |||:..|..|||||......|:|:|...::..||..|:.||....:.|
  Rat   141 VQGG---MIGNFI----SIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD 198

  Fly   241 NREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYK 305
            .....|:::.|.|:..|:.|.|.|||::|:|||.....||...|||:||||.:..:.|||.|:||
  Rat   199 TVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCSGYKGTLDCLLQTWKNEGFFALYK 263

  Fly   306 GFIPYWMRVGPASVVFWMTFEQIRR 330
            ||.|.|:|:||.:::|::|:||:::
  Rat   264 GFWPNWLRLGPWNIIFFLTYEQLKK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 93/259 (36%)
Mito_carr 32..129 CDD:278578 31/82 (38%)
Mito_carr 138..233 CDD:278578 30/94 (32%)
Mito_carr 246..331 CDD:278578 39/85 (46%)
Slc25a30NP_001013205.1 Solcar 1 7..96 31/80 (39%)
PTZ00169 9..289 CDD:240302 105/285 (37%)
Solcar 2 104..189 30/95 (32%)
Solcar 3 198..289 40/91 (44%)
Mito_carr 199..289 CDD:395101 39/90 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.