DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG8026

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:326 Identity:81/326 - (24%)
Similarity:138/326 - (42%) Gaps:60/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAM 88
            |.|:||            ...:....:.::.:|.|:.|.|..:..   .|.....:||||.:...
  Fly    22 KYEHLV------------AGVSGGVVSTLILHPLDLIKIRFAVND---GRTATVPQYRGLSSAFT 71

  Fly    89 GIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGR------PQLSFLGSCIS 147
            .|.|:||...||.|::..::......|:..:.|:.::..:    :.|.      |.::.|.:..|
  Fly    72 TIFRQEGFRGLYKGVTPNVWGSGSSWGLYFMFYNTIKTFI----QGGNTTMPLGPTMNMLAAAES 132

  Fly   148 GVLAGATASVLTNPTELIK----IQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTV 208
            |:|    ..:||||..::|    :|.........||       ::.||..||:..|:.||::|.|
  Fly   133 GIL----TLLLTNPIWVVKTRLCLQCDAASSAEYRG-------MIHALGQIYKEEGIRGLYRGFV 186

  Fly   209 PNTWRSALVTIGDVS--CYDFCK------RFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADV 265
            |....   |:.|.:.  .|:..|      |.|..:..|.....:.| ||::..:| |..:.|..|
  Fly   187 PGMLG---VSHGAIQFMTYEELKNAYNEYRKLPIDTKLATTEYLAF-AAVSKLIA-AAATYPYQV 246

  Fly   266 VKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            |::|:.    |...|   |.|:.||:.:..|.||:...|||......||.||.:|.::.:|.:..
  Fly   247 VRARLQ----DHHHR---YNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSH 304

  Fly   331 F 331
            |
  Fly   305 F 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 68/291 (23%)
Mito_carr 32..129 CDD:278578 18/96 (19%)
Mito_carr 138..233 CDD:278578 27/106 (25%)
Mito_carr 246..331 CDD:278578 27/84 (32%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 74/306 (24%)
Mito_carr 23..115 CDD:278578 21/110 (19%)
Mito_carr 119..213 CDD:278578 27/107 (25%)
Mito_carr 220..307 CDD:278578 29/95 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.