DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Ucp4C

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:326 Identity:131/326 - (40%)
Similarity:196/326 - (60%) Gaps:11/326 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EEKERPKLEYLVTNKKTPPV-----ELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQ- 76
            |.:|.|:  :..||...|..     :||:..|..|..||...:|.|:.|||||:.||.|.:.|: 
  Fly    15 EIEEEPR--FPPTNVADPLTARNLFQLYVNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKA 77

  Fly    77 KAKYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSF 141
            ...:|   ||...::|.||...||.|.|||:.|:.:|:.::::.||..|...:..:|.....|..
  Fly    78 MPTFR---ATLTNMIRVEGFKSLYAGFSAMVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKI 139

  Fly   142 LGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKG 206
            ..:......||..|..|.||.:::|::||.||:||..|...|:::::||...|||.||:..:|||
  Fly   140 YMALGCSFTAGCIAQALANPFDIVKVRMQTEGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKG 204

  Fly   207 TVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIM 271
            ..|:..|:.|:|.|||..||..||......||.:...::||::|.||:..::||.||||:|||:|
  Fly   205 VGPSCMRACLMTTGDVGSYDISKRTFKRLLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMM 269

  Fly   272 NQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRGSEG 336
            |||.||.|:.::||.||||:.:||||||.|.:|||.:|.|.|:||.||:||::.||:|::.|..|
  Fly   270 NQPVDESGKNLYYKNSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFWLSVEQLRQWEGQSG 334

  Fly   337 Y 337
            :
  Fly   335 F 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 110/279 (39%)
Mito_carr 32..129 CDD:278578 35/102 (34%)
Mito_carr 138..233 CDD:278578 37/94 (39%)
Mito_carr 246..331 CDD:278578 49/84 (58%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 29/77 (38%)
Mito_carr 137..232 CDD:278578 37/94 (39%)
Mito_carr 237..329 CDD:278578 49/91 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468821
Domainoid 1 1.000 92 1.000 Domainoid score I2582
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D64492at33392
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.