DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Ucp4A

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:334 Identity:150/334 - (44%)
Similarity:219/334 - (65%) Gaps:10/334 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NTVFRPAEWDNSEEKERPKLEYLVTNKKTPPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEI 70
            :|...||......:....|.:|..:...|     |:.:..:|..||:..||.|:.|||:|||||.
  Fly    15 STSSNPAPSSGRHQLRPVKFDYADSFACT-----YIVSVVAASIAELATYPLDLTKTRLQIQGEG 74

  Fly    71 ASRVGQKA--KYRGLLATAMGIVREEGLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDE 133
            |:....|:  :|||::|||.||.||||.|||:.|::..|:||.::||:::.:||.||::.   .:
  Fly    75 AAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRKEF---TQ 136

  Fly   134 DGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQRRLRGEPPRIHNVLQALTSIYRTG 198
            :|...|....|.:.||.|||.|..|.:|.:|:|:|:||||:|||.|||||:|:...|...|.:.|
  Fly   137 NGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEGRRRLMGEPPRVHSAGHAFRQIVQRG 201

  Fly   199 GVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPA 263
            |:.|||||::||..|:|||.:||::.||..|..::....:.|...|..:|::.||...||:..||
  Fly   202 GIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIMNRLQMPDCHTVHVLASVCAGFVAAIMGTPA 266

  Fly   264 DVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQI 328
            ||||:|||||||||.|||:.|:||:|||.:.|.:|||:|:||||:|.|:|:.|.|:.||::||||
  Fly   267 DVVKTRIMNQPTDENGRGLLYRGSVDCLRQTVSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331

  Fly   329 RRFRGSEGY 337
            |:..|:.||
  Fly   332 RKMIGASGY 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 127/275 (46%)
Mito_carr 32..129 CDD:278578 43/98 (44%)
Mito_carr 138..233 CDD:278578 46/94 (49%)
Mito_carr 246..331 CDD:278578 50/84 (60%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 142/303 (47%)
Mito_carr 39..138 CDD:278578 43/106 (41%)
Mito_carr 142..239 CDD:278578 46/96 (48%)
Mito_carr 248..336 CDD:278578 50/87 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468822
Domainoid 1 1.000 92 1.000 Domainoid score I2582
eggNOG 1 0.900 - - E1_KOG0759
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 247 1.000 Inparanoid score I1045
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D64492at33392
OrthoFinder 1 1.000 - - FOG0004436
OrthoInspector 1 1.000 - - otm3431
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3722
109.900

Return to query results.
Submit another query.