DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Ant2

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:311 Identity:64/311 - (20%)
Similarity:130/311 - (41%) Gaps:45/311 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGIS 104
            ::....||..|:....|.:..|..:|:| |::.::....:|:|::...:.|.:|:|....:.|..
  Fly    22 FMMGGVSAAIAKTAVAPIERVKLILQVQ-EVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNL 85

  Fly   105 AMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQL--SFLGSCISGVLAGATASVLTNPTELIKI 167
            |.:.|:.....:.....| :.:.:.:...|...|.  .|.|:..||..||||:.....|.:..:.
  Fly    86 ANVIRYFPTQALNFAFKD-VYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFART 149

  Fly   168 QMQME----GQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFC 228
            ::..:    |.|...|       ::..|..:.::.|.:||::|.:.:.....:........||.|
  Fly   150 RLAADVGKGGNREFNG-------LIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDTC 207

  Fly   229 KRFL-------------IAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGR 280
            :.||             ||:           |....||:|    |.|.|.|:.|:|.|...::..
  Fly   208 RDFLPNPKSTPFYVSWAIAQ-----------VVTTVAGIA----SYPFDTVRRRMMMQSGLKKSE 257

  Fly   281 GIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRF 331
            .: ||.:..|...:.::||..|.:||.:...:| |....:....:::::::
  Fly   258 MV-YKNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMKKY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 60/284 (21%)
Mito_carr 32..129 CDD:278578 17/88 (19%)
Mito_carr 138..233 CDD:278578 23/113 (20%)
Mito_carr 246..331 CDD:278578 21/84 (25%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 64/308 (21%)
Mito_carr 17..111 CDD:278578 17/90 (19%)
Mito_carr 119..215 CDD:278578 22/102 (22%)
Mito_carr 218..307 CDD:278578 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.