DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and CG5254

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:291 Identity:79/291 - (27%)
Similarity:130/291 - (44%) Gaps:29/291 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FASACSAEIVGYPFDMCKTRMQIQGEIASRVGQ--KAKYRGLLATAMGIVREEGLLKLYGGISAM 106
            |...|    :..|.|:.|||:|||...|.....  :..|.|:......:.|.||:...:.||...
  Fly    26 FLEVC----IMQPLDVVKTRIQIQATPAPNAAALGEVHYNGVFDCFAKMYRHEGISSYWKGIMPP 86

  Fly   107 LFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQM 171
            :...:....||.|.::..:...    :.|.|..:.|...::|:.||...::..||.|::|:..|.
  Fly    87 ILAETPKRAIKFLVFEQTKPLF----QFGSPTPTPLTFSLAGLTAGTLEAIAVNPFEVVKVAQQA 147

  Fly   172 EGQRRLRGEPPRIHNVLQALTSIYRTG-GVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAE 235
            :.|:::      :.....|...|.:.| |..||.||......|:.:..:.....|...|. ::.|
  Fly   148 DRQKKM------LSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKN-VVPE 205

  Fly   236 FDLVDNREVQFVAAMT----AGVADAILSLPADVVKSRIMN-QPTDEQGRGIHYKGSLDCLSRLV 295
            :   ....::|:..:|    ||.....:::|.||.||||.. ||...|   |.|:|:|..:..:.
  Fly   206 Y---KESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQPVPGQ---IKYRGTLSSMGIVY 264

  Fly   296 REEGFLAMYKGFIPYWMRVGPASVVFWMTFE 326
            |||||.|:|||.:|..||:||...:..:.||
  Fly   265 REEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 70/269 (26%)
Mito_carr 32..129 CDD:278578 21/86 (24%)
Mito_carr 138..233 CDD:278578 21/95 (22%)
Mito_carr 246..331 CDD:278578 34/86 (40%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 21/93 (23%)
PTZ00169 19..301 CDD:240302 79/291 (27%)
Mito_carr 122..207 CDD:278578 21/94 (22%)
Mito_carr 209..305 CDD:278578 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441697
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.