DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and misc-1

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_493694.2 Gene:misc-1 / 173414 WormBaseID:WBGene00015186 Length:306 Species:Caenorhabditis elegans


Alignment Length:295 Identity:92/295 - (31%)
Similarity:155/295 - (52%) Gaps:14/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PPVELYLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKL 99
            |.|..:.....:...|.:|..|.|:.|.|||:.|...     |.:||..:.....|::.||:..:
 Worm     8 PNVVKFAFGGTAGMGATLVVQPLDLVKNRMQLSGTTG-----KKEYRSSMHALTSIMKNEGVFAV 67

  Fly   100 YGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTEL 164
            |.|:||.|.|.:.::..::.||.::.|:....|:    .|||....:.|:.||...|.:..|.|:
 Worm    68 YNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDK----PLSFGMKAVLGMTAGGIGSFVGTPAEI 128

  Fly   165 IKIQMQMEGQRRLRGEPPRIH-NVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFC 228
            ..|:|..:|  ||..|..|.: .|:.|||.|.:..||:.||:|..|...|:.:|....::.|...
 Worm   129 ALIRMTGDG--RLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQA 191

  Fly   229 KRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSR 293
            |:.|:|...:.|.....|:|:|.:|:|..|.|:|.|:.|:||.:....: |:. .||.:.|...:
 Worm   192 KQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVID-GKP-EYKNAFDVWGK 254

  Fly   294 LVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQI 328
            :::.||..|::|||.||:||:||.:|:.::..||:
 Worm   255 VIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQM 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 80/271 (30%)
Mito_carr 32..129 CDD:278578 26/93 (28%)
Mito_carr 138..233 CDD:278578 31/95 (33%)
Mito_carr 246..331 CDD:278578 31/83 (37%)
misc-1NP_493694.2 Mito_carr 7..99 CDD:278578 26/95 (27%)
Mito_carr 101..196 CDD:278578 31/100 (31%)
Mito_carr 202..296 CDD:278578 32/90 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.