DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and Slc25a10

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:302 Identity:92/302 - (30%)
Similarity:145/302 - (48%) Gaps:38/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGIS 104
            |....|| |.|....:|.|:.|..:|.|.|:      |.:..|:   |:.:||.:|.|.||.|:|
  Rat    10 YFGGLAS-CGAACCTHPLDLLKVHLQTQQEV------KLRMTGM---ALQVVRTDGFLALYNGLS 64

  Fly   105 AMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQM 169
            |.|.|...:|..:...|:.||:.|   .:|.:..|.|....:.|.::|.|...:..|.:|:.::|
  Rat    65 ASLCRQMTYSLTRFAIYETMRDYM---TKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRM 126

  Fly   170 QME-----GQRRLRGEPPRIHNVLQALTSIYRTG---GVVGLWKGTVPNTWRSALVTIGDVSCYD 226
            |.:     .|||         |...||..:||..   |:..|:.|....:.|.||||:|.:||||
  Rat   127 QNDMKLPLSQRR---------NYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYD 182

  Fly   227 FCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCL 291
            ..|:.:::...|.||....|:::..||.....|..|.||:|:|:||...:       |:|...|.
  Rat   183 QAKQLVLSTGYLSDNIFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSKGE-------YQGVFHCA 240

  Fly   292 SRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRRFRG 333
            ....: .|..|.:||.:|..:|:.|.:|:.:|..||:|:..|
  Rat   241 VETAK-LGPQAFFKGLVPAGVRLVPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 81/273 (30%)
Mito_carr 32..129 CDD:278578 29/88 (33%)
Mito_carr 138..233 CDD:278578 31/102 (30%)
Mito_carr 246..331 CDD:278578 26/84 (31%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 29/92 (32%)
Mito_carr 94..189 CDD:395101 31/103 (30%)
Mito_carr 197..283 CDD:395101 28/93 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.