DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ucp4B and ucp3

DIOPT Version :9

Sequence 1:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster
Sequence 2:XP_002942565.1 Gene:ucp3 / 100495495 XenbaseID:XB-GENE-6464668 Length:309 Species:Xenopus tropicalis


Alignment Length:306 Identity:101/306 - (33%)
Similarity:165/306 - (53%) Gaps:25/306 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTPPVEL--YLTAFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKA-KYRGLLATAMGIVREE 94
            :.||..|  ::.|..:||.|::..:|.|..|.|:|||||..|....|. :|:|:..|...:|:.|
 Frog     8 EVPPTPLVKFVGAGTAACIADLFTFPLDTAKVRLQIQGEGTSVKDTKVLRYKGVFGTIKTMVKTE 72

  Fly    95 GLLKLYGGISAMLFRHSLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLT 159
            |...||.|:.|.|.|...|:.|::..||.:::......|........|..|.:    ||.|..|.
 Frog    73 GATSLYNGLVAGLQRQMSFASIRIGLYDSVKQFYCRQSESSGVACRLLAGCTT----GAMAVTLA 133

  Fly   160 NPTELIKIQMQ-----MEGQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTI 219
            .||:::|::.|     |:|:||..|       .:.|..:|.:..|:.||||||:.|..|:|:|..
 Frog   134 QPTDVVKVRFQAHIKVMDGERRYNG-------TVDAYKTIAKEEGLRGLWKGTIANITRNAIVNC 191

  Fly   220 GDVSCYDFCKRFLIAEFDLVDNREVQFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHY 284
            .::..||..|..::.:..:.||....||||..||....:::.|.||||:|.||.|..:      |
 Frog   192 AELVTYDLIKETILNQRLMTDNLPCHFVAAFGAGFCATVVASPVDVVKTRYMNSPAGQ------Y 250

  Fly   285 KGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQIRR 330
            |.:|:|...::.:||.:|.||||:|.::|:|..::|.::::||::|
 Frog   251 KNALNCAFIMLVKEGSVAFYKGFMPAFLRLGSWNIVMFVSYEQLKR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 91/280 (33%)
Mito_carr 32..129 CDD:278578 34/98 (35%)
Mito_carr 138..233 CDD:278578 31/99 (31%)
Mito_carr 246..331 CDD:278578 33/85 (39%)
ucp3XP_002942565.1 PTZ00169 14..299 CDD:240302 99/300 (33%)
Mito_carr 111..206 CDD:395101 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D382447at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.